PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779179.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 177aa    MW: 20490.2 Da    PI: 9.064
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779179.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.52.6e-161664250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     +e+k  r+vtfskR++ ++ KAeE S+ ++a++ v++fs++gk   ys
  XP_009779179.1 16 YVESKEARYVTFSKRKASLFRKAEEFSTVTGADIGVLLFSPSGKPCSYS 64
                    5799***************************************987777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-23766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.647767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.28E-22884IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-13929IPR002100Transcription factor, MADS-box
PfamPF003194.7E-191763IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-132944IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-134465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MARRTSKGRQ KIEMKYVESK EARYVTFSKR KASLFRKAEE FSTVTGADIG VLLFSPSGKP  60
CSYSSTSVEK ITEKFCEWKQ QNVDEGKSSV FQAFDDLCKD IQDENEKEKR RELRYKVMYP  120
GAEIPPDKER SEKLVEIKLR LDKINEAAKN HIRAERLKFD LNVVPEYEVG ESSGTHH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779179.11e-129PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLM1AZT99e-73M1AZT9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000338613e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17801260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.15e-19AGAMOUS-like 29